Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf71 Peptide - middle region

C16orf71 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686H2240, FLJ43261

UniProt

Q8IYS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C16orf71 Rabbit Polyclonal Antibody (orb581797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631909

Preservative

Lyophilized powder

AA Sequence

GKSQLLQQLRAFQKGTAQPELPASKGPAGGRAQAPEDTAGSRTGRKQHMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD350 tyramide reagent
11067-AAT 200 Slides

XFD350 tyramide reagent

Sign In for Pricing
View Details
3,4'-Diisopropyl-1,1'-biphenyl
TRC-D492345-250MG 250 mg

3,4'-Diisopropyl-1,1'-biphenyl

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS503277 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Disperse Blue 3 (20% dye content)
TRC-D509350-100MG 100 mg

Disperse Blue 3 (20% dye content)

Sign In for Pricing
View Details
Apolipoprotein O (APOO) Mouse Monoclonal Antibody [Clone ID: 2F1]
AM06315SU-N 100 µL

Apolipoprotein O (APOO) Mouse Monoclonal Antibody [Clone ID: 2F1]

Sign In for Pricing
View Details
MAGED1 (NM_001005332) Human Over-expression Lysate
LC423858 20 µg

MAGED1 (NM_001005332) Human Over-expression Lysate

Sign In for Pricing
View Details