Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf73 Peptide - middle region

C16orf73 Peptide - middle region

Product Specifications

Product Name Alternative

MGC35212, gs129, C16orf73

UniProt

Q8N635

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C16orf73 Rabbit Polyclonal Antibody (orb326006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689977

Preservative

Lyophilized powder

AA Sequence

CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9430016H08Rik (BC024945) Mouse Tagged ORF Clone
MG201651 10 µg

9430016H08Rik (BC024945) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD59 Mouse Monoclonal Antibody [Clone ID: NaM172-2B5]
AM39024RP-N 100 Tests

CD59 Mouse Monoclonal Antibody [Clone ID: NaM172-2B5]

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF640R conjugate, 0.1mg/mL
BNC403006-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Usb1 Antibody
KC-2836-01 50 μL

Usb1 Antibody

Sign In for Pricing
View Details
Usb1 Antibody
KC-2836-02 100 µL

Usb1 Antibody

Sign In for Pricing
View Details
Usb1 Antibody
KC-2836-03 1 mL

Usb1 Antibody

Sign In for Pricing
View Details