Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf73 Peptide - middle region

C16orf73 Peptide - middle region

Product Specifications

Product Name Alternative

MGC35212, gs129, C16orf73

UniProt

Q8N635

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C16orf73 Rabbit Polyclonal Antibody (orb326006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689977

Preservative

Lyophilized powder

AA Sequence

CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRHL2 (NM_024915) Human Recombinant Protein
TP314498L 1 mg

GRHL2 (NM_024915) Human Recombinant Protein

Sign In for Pricing
View Details
Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF488A conjugate, 0.1mg/mL
BNC883136-100 1x 100 µL

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human APIP activation kit by CRISPRa
GA109540 1 Kit

Human APIP activation kit by CRISPRa

Sign In for Pricing
View Details
CYP11B1 (NM_001026213) Human Over-expression Lysate
LY422463 100 µg

CYP11B1 (NM_001026213) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Chlorobenzaldehyde-2,3,5,6-d4
TRC-C364592-10MG 10 mg

4-Chlorobenzaldehyde-2,3,5,6-d4

Sign In for Pricing
View Details
Hinokitiol
TRC-H341000-1G 1 g

Hinokitiol

Sign In for Pricing
View Details