C17orf48 Peptide - N-terminal region
C17orf48 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MDS006, NBLA03831, C17orf48
UniProt
Q3LIE5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C17orf48 Rabbit Polyclonal Antibody (orb326197) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064618
Preservative
Lyophilized powder
AA Sequence
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400158-100 1x 100 µL
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940096-500 1x 500 µL
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details