Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf48 Peptide - middle region

C17orf48 Peptide - middle region

Product Specifications

Product Name Alternative

MDS006, NBLA03831, C17orf48

UniProt

Q3LIE5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C17orf48 Rabbit Polyclonal Antibody (orb326198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064618

Preservative

Lyophilized powder

AA Sequence

KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MTA3 shRNA Plasmid
abx961489-01 150 µg

Human MTA3 shRNA Plasmid

Sign In for Pricing
View Details
Human MTA3 shRNA Plasmid
abx961489-02 300 µg

Human MTA3 shRNA Plasmid

Sign In for Pricing
View Details
MAP2 (Microtubule-associated Protein 2, MAP-2, DKFZp686I2148) (MaxLight 550)
MBS6384781-01 0.1 mL

MAP2 (Microtubule-associated Protein 2, MAP-2, DKFZp686I2148) (MaxLight 550)

Sign In for Pricing
View Details
MAP2 (Microtubule-associated Protein 2, MAP-2, DKFZp686I2148) (MaxLight 550)
MBS6384781-02 5x 0.1 mL

MAP2 (Microtubule-associated Protein 2, MAP-2, DKFZp686I2148) (MaxLight 550)

Sign In for Pricing
View Details
Bis-Tos-PEG6
orb1909238-01 100 mg

Bis-Tos-PEG6

Sign In for Pricing
View Details
Bis-Tos-PEG6
orb1909238-02 500 mg

Bis-Tos-PEG6

Sign In for Pricing
View Details