Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf75 Peptide - middle region

C17orf75 Peptide - middle region

Product Specifications

Product Name Alternative

NJMU-R1

UniProt

Q9HAS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C17orf75 Rabbit Polyclonal Antibody (orb583643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071739

Preservative

Lyophilized powder

AA Sequence

KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc tag, AlpHcAbs® Rabbit antibody
HA710209 100 µg

Myc tag, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
MAP2K2 Polyclonal Antibody
E-AB-12553-01 20 µL

MAP2K2 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K2 Polyclonal Antibody
E-AB-12553-02 60 µL

MAP2K2 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K2 Polyclonal Antibody
E-AB-12553-03 120 µL

MAP2K2 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K2 Polyclonal Antibody
E-AB-12553-04 200 µL

MAP2K2 Polyclonal Antibody

Sign In for Pricing
View Details
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Over-expression Lysate
LC422018 20 µg

15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Over-expression Lysate

Sign In for Pricing
View Details