Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf75 Peptide - middle region

C17orf75 Peptide - middle region

Product Specifications

Product Name Alternative

NJMU-R1

UniProt

Q9HAS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C17orf75 Rabbit Polyclonal Antibody (orb583643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071739

Preservative

Lyophilized powder

AA Sequence

KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorprothixene-d6
TRC-C424912-5MG 5 mg

Chlorprothixene-d6

Sign In for Pricing
View Details
Human SERTAD1 activation kit by CRISPRa
GA109335 1 Kit

Human SERTAD1 activation kit by CRISPRa

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF640R conjugate, 0.1mg/mL
BNC400282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AP2A2 Rabbit Polyclonal Antibody
HA500477 100 µL

AP2A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cesium Iodide
TRC-C280018-250MG 250 mg

Cesium Iodide

Sign In for Pricing
View Details
Vacuum Oven BOVA-7404
BOVA-7404 1 Unit

Vacuum Oven BOVA-7404

Sign In for Pricing
View Details