Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf18 Peptide - N-terminal region

C19orf18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC41906

UniProt

Q8NEA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C19orf18 Rabbit Polyclonal Antibody (orb581910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689687

Preservative

Lyophilized powder

AA Sequence

NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human monokine induced by interferon-gamma (MIG; CXCL9) ELISA Kit
YP-W10297-01 48 Tests

Human monokine induced by interferon-gamma (MIG; CXCL9) ELISA Kit

Sign In for Pricing
View Details
Human monokine induced by interferon-gamma (MIG; CXCL9) ELISA Kit
YP-W10297-02 96 Tests

Human monokine induced by interferon-gamma (MIG; CXCL9) ELISA Kit

Sign In for Pricing
View Details
OR1D5 AAV siRNA Pooled Vector
34992161 1.0 µg

OR1D5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rad51D Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61028R-BF555-TR 20 µL

Rad51D Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
IGF2 Rabbit Polyclonal Antibody (Biotin)
orb114174 100 µL

IGF2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SCO2 (NM_005138) Human Over-expression Lysate
LY417499 100 µg

SCO2 (NM_005138) Human Over-expression Lysate

Sign In for Pricing
View Details