Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf18 Peptide - N-terminal region

C19orf18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC41906

UniProt

Q8NEA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C19orf18 Rabbit Polyclonal Antibody (orb581910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689687

Preservative

Lyophilized powder

AA Sequence

NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APPL1 Peptide
orb1234424 0.1 mg

APPL1 Peptide

Sign In for Pricing
View Details
FZR1 Protein Vector (Mouse) (pPB-N-His)
PV180771 500 ng

FZR1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Heca sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6165908 1.0 µg DNA

Heca sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Nfkb2 ORF Vector (Mouse) (pORF)
ORF051316 1.0 µg DNA

Nfkb2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GMFB Knockout HEK293T Polyclonal Cells
ARG3376 1 Million

GMFB Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Add1 (NM_013457) Mouse Tagged ORF Clone Lentiviral Particle
MR220940L4V 200 µL

Add1 (NM_013457) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details