Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX45 Peptide - middle region

TEX45 Peptide - middle region

Product Specifications

Product Name Alternative

C19orf45

UniProt

Q8NA69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX45 Rabbit Polyclonal Antibody (orb582938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940936

Preservative

Lyophilized powder

AA Sequence

QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Infectious Bursal Disease Virus, VP2 (IBD, IBDV) (PE)
MBS6129381-01 0.1 mL

Infectious Bursal Disease Virus, VP2 (IBD, IBDV) (PE)

Sign In for Pricing
View Details
Infectious Bursal Disease Virus, VP2 (IBD, IBDV) (PE)
MBS6129381-02 5x 0.1 mL

Infectious Bursal Disease Virus, VP2 (IBD, IBDV) (PE)

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
RD219168A-01 20 µL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
RD219168A-02 60 μL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
RD219168A-03 120 μL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
RD219168A-04 200 µL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details