Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf131 Peptide - middle region

C1orf131 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp547B1713

UniProt

Q8NDD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1orf131 Rabbit Polyclonal Antibody (orb581882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689592

Preservative

Lyophilized powder

AA Sequence

TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 3 (AQP3) (NM_004925) Human Tagged ORF Clone
RC201856 10 µg

Aquaporin 3 (AQP3) (NM_004925) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human CDKN2C Protein
orb2995186-01 10 µg

Recombinant Human CDKN2C Protein

Sign In for Pricing
View Details
Recombinant Human CDKN2C Protein
orb2995186-02 50 µg

Recombinant Human CDKN2C Protein

Sign In for Pricing
View Details
Recombinant Human CDKN2C Protein
orb2995186-03 500 µg

Recombinant Human CDKN2C Protein

Sign In for Pricing
View Details
Recombinant Human CDKN2C Protein
orb2995186-04 1 mg

Recombinant Human CDKN2C Protein

Sign In for Pricing
View Details
Recombinant Human ILT6 / LILRA3 Protein (His tag)
ARP6925-01 10 µg

Recombinant Human ILT6 / LILRA3 Protein (His tag)

Sign In for Pricing
View Details