Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf43 Peptide - middle region

C1orf43 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp586G1722, HSPC012, MGC111001, NICE-3, NS5ATP4, S863-3

UniProt

Q9BWL3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1orf43 Rabbit Polyclonal Antibody (orb582374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092086

Preservative

Lyophilized powder

AA Sequence

YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Beta-klotho (KLB) ELISA kit
CSB-EL012378HU-01 48 Tests

Human Beta-klotho (KLB) ELISA kit

Sign In for Pricing
View Details
Human Beta-klotho (KLB) ELISA kit
CSB-EL012378HU-02 96 Tests

Human Beta-klotho (KLB) ELISA kit

Sign In for Pricing
View Details
Human Beta-klotho (KLB) ELISA kit
CSB-EL012378HU-03 5x 96 Tests

Human Beta-klotho (KLB) ELISA kit

Sign In for Pricing
View Details
Human Beta-klotho (KLB) ELISA kit
CSB-EL012378HU-04 10x 96 Tests

Human Beta-klotho (KLB) ELISA kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Frataxin (FXN)
MBS2066121-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Frataxin (FXN)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Frataxin (FXN)
MBS2066121-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Frataxin (FXN)

Sign In for Pricing
View Details