Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIART Peptide - middle region

CIART Peptide - middle region

Product Specifications

Product Name Alternative

GM129, CHRONO, C1orf51

UniProt

Q8N365

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIART Rabbit Polyclonal Antibody (orb581816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653298

Preservative

Lyophilized powder

AA Sequence

GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAS190792
MBS5816647 Inquire

LAS190792

Sign In for Pricing
View Details
ARHGAP1 (NM_004308) Human Over-expression Lysate
LC418075 20 µg

ARHGAP1 (NM_004308) Human Over-expression Lysate

Sign In for Pricing
View Details
Hic1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4813107 1.0 µg DNA

Hic1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-SDPR Polyclonal Antibody
TMAB-12610-01 50 μL

Anti-SDPR Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SDPR Polyclonal Antibody
TMAB-12610-02 100 µL

Anti-SDPR Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SDPR Polyclonal Antibody
TMAB-12610-03 200 µL

Anti-SDPR Polyclonal Antibody

Sign In for Pricing
View Details