Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIART Peptide - middle region

CIART Peptide - middle region

Product Specifications

Product Name Alternative

GM129, CHRONO, C1orf51

UniProt

Q8N365

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIART Rabbit Polyclonal Antibody (orb581816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653298

Preservative

Lyophilized powder

AA Sequence

GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT / TAU (Isoform 13) mouse monoclonal antibody, clone C45, Aff - Purified
AM00187PU-N 100 µL

MAPT / TAU (Isoform 13) mouse monoclonal antibody, clone C45, Aff - Purified

Sign In for Pricing
View Details
Rabbit IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ValidElisa Kit
EK346627 96 Well

Rabbit IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ValidElisa Kit

Sign In for Pricing
View Details
INHBB Recombinant Protein
OPCD04484-50UG 50 µg

INHBB Recombinant Protein

Sign In for Pricing
View Details
Cdc25a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7042208 1.0 µg DNA

Cdc25a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Goat anti-apolipoprotein A2 antibody ELISA Kit
MBS7280054-01 48 Well

Goat anti-apolipoprotein A2 antibody ELISA Kit

Sign In for Pricing
View Details
Goat anti-apolipoprotein A2 antibody ELISA Kit
MBS7280054-02 96 Well

Goat anti-apolipoprotein A2 antibody ELISA Kit

Sign In for Pricing
View Details