C1orf96 Peptide - middle region
C1orf96 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ37296, FLJ41471, RP4-803J11.3, C1orf96
UniProt
Q6IQ19
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C1orf96 Rabbit Polyclonal Antibody (orb581851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660300
Preservative
Lyophilized powder
AA Sequence
ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN404484 1 Kit
Corneodesmosin (CDSN) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
GTR15170536 1 Vial
Lentiviral mouse Tnfrsf23 shRNA (UAS) - Lentiviral mouse Tnfrsf23 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details K3064805 3x 1.0 µg
Vmn1r114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details AD20H200-A11B 1 Each
Heated Circulator, 20L, Advanced Digital (Ambient +10° to 200°C), 120V, 60Hz
Sign In for Pricing
View Details