Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf96 Peptide - middle region

C1orf96 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ37296, FLJ41471, RP4-803J11.3, C1orf96

UniProt

Q6IQ19

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1orf96 Rabbit Polyclonal Antibody (orb581851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660300

Preservative

Lyophilized powder

AA Sequence

ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEK Rabbit Polyclonal Antibody (BF555)
orb2555858 100 µL

DEK Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Human CD69 Protein, hFc Tag
MBS188799-01 0.01 mg

Human CD69 Protein, hFc Tag

Sign In for Pricing
View Details
Human CD69 Protein, hFc Tag
MBS188799-02 0.05 mg

Human CD69 Protein, hFc Tag

Sign In for Pricing
View Details
Human CD69 Protein, hFc Tag
MBS188799-03 0.1 mg

Human CD69 Protein, hFc Tag

Sign In for Pricing
View Details
Human CD69 Protein, hFc Tag
MBS188799-04 5x 0.1 mg

Human CD69 Protein, hFc Tag

Sign In for Pricing
View Details
Anti-EpCAM Antibody, Rabbit Polyclonal
MBS8112924-01 0.1 mL

Anti-EpCAM Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details