Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QA Peptide - N-terminal region

C1QA Peptide - N-terminal region

Product Specifications

UniProt

P02745

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QA Rabbit Polyclonal Antibody (orb584559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057075

Preservative

Lyophilized powder

AA Sequence

PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDC2 (NM_014460) Human Recombinant Protein
TP308989 20 µg

CSDC2 (NM_014460) Human Recombinant Protein

Sign In for Pricing
View Details
DNAJA2 Human Gene Knockout Kit (CRISPR)
KN402204 1 Kit

DNAJA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLX4IP (NM_001009608) Human Over-expression Lysate
LC422923 20 µg

SLX4IP (NM_001009608) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ACTR8 activation kit by CRISPRa
GA114305 1 Kit

Human ACTR8 activation kit by CRISPRa

Sign In for Pricing
View Details
RASSF10 (NM_001080521) Human Over-expression Lysate
LY421076 100 µg

RASSF10 (NM_001080521) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS803896 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details