Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QA Peptide - N-terminal region

C1QA Peptide - N-terminal region

Product Specifications

UniProt

P02745

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QA Rabbit Polyclonal Antibody (orb584559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057075

Preservative

Lyophilized powder

AA Sequence

PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD26L (ERCC6L2) (NM_001010895) Human Over-expression Lysate
LY423215 100 µg

RAD26L (ERCC6L2) (NM_001010895) Human Over-expression Lysate

Sign In for Pricing
View Details
Pyridine-2,6-d2
TRC-P998912-50MG 50 mg

Pyridine-2,6-d2

Sign In for Pricing
View Details
Mid1ip1 (NM_026524) Mouse Tagged ORF Clone
MG201647 10 µg

Mid1ip1 (NM_026524) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-MEK1/2 (S218 + S222) Recombinant Rabbit Monoclonal Antibody [ST0490]
ET1609-50 100 µL

Phospho-MEK1/2 (S218 + S222) Recombinant Rabbit Monoclonal Antibody [ST0490]

Sign In for Pricing
View Details
RXFP2 Polyclonal Antibody
E-AB-90846-01 60 µL

RXFP2 Polyclonal Antibody

Sign In for Pricing
View Details
RXFP2 Polyclonal Antibody
E-AB-90846-02 120 µL

RXFP2 Polyclonal Antibody

Sign In for Pricing
View Details