Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf132 Peptide - middle region

C20orf132 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434N0426, FLJ36113, dJ621N11.4, C20orf131, dJ621N11.3, C20orf132

UniProt

Q9H579

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C20orf132 Rabbit Polyclonal Antibody (orb582108) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998797

Preservative

Lyophilized powder

AA Sequence

PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bexagliflozin
TRC-B336785-250MG 250 mg

Bexagliflozin

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific,
AAF-532-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific,

Sign In for Pricing
View Details
Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL
BNC940091-100 1x 100 µL

Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS637715 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
CASKIN2 (NM_001142643) Human Over-expression Lysate
LC428227 20 µg

CASKIN2 (NM_001142643) Human Over-expression Lysate

Sign In for Pricing
View Details
m-Cresol-d7
TRC-C781917-50MG 50 mg

m-Cresol-d7

Sign In for Pricing
View Details