C20orf132 Peptide - middle region
C20orf132 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp434N0426, FLJ36113, dJ621N11.4, C20orf131, dJ621N11.3, C20orf132
UniProt
Q9H579
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C20orf132 Rabbit Polyclonal Antibody (orb582108) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_998797
Preservative
Lyophilized powder
AA Sequence
PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940029-500 1x 500 µL
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040515-500 1x 500 µL
CD79a (IGA/515), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 