Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC75B Peptide - middle region

LRRC75B Peptide - middle region

Product Specifications

Product Name Alternative

FAM211B, C22orf36

UniProt

Q2VPJ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC75B Rabbit Polyclonal Antibody (orb582977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997527

Preservative

Lyophilized powder

AA Sequence

WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Fibronectin (FN)
TRV-0048639-01 20 µL

Polyclonal Antibody to Fibronectin (FN)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibronectin (FN)
TRV-0048639-02 100 µL

Polyclonal Antibody to Fibronectin (FN)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibronectin (FN)
TRV-0048639-03 200 µL

Polyclonal Antibody to Fibronectin (FN)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibronectin (FN)
TRV-0048639-04 1 mL

Polyclonal Antibody to Fibronectin (FN)

Sign In for Pricing
View Details
Methyl 3-[imino (methyl) oxo-λ6-sulfanyl]benzoate
CRB73086-01 50 mg

Methyl 3-[imino (methyl) oxo-λ6-sulfanyl]benzoate

Sign In for Pricing
View Details
Methyl 3-[imino (methyl) oxo-λ6-sulfanyl]benzoate
CRB73086-02 0.5 g

Methyl 3-[imino (methyl) oxo-λ6-sulfanyl]benzoate

Sign In for Pricing
View Details