Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC75B Peptide - middle region

LRRC75B Peptide - middle region

Product Specifications

Product Name Alternative

FAM211B, C22orf36

UniProt

Q2VPJ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC75B Rabbit Polyclonal Antibody (orb582977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997527

Preservative

Lyophilized powder

AA Sequence

WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAAV00271-200UG - Breast Epithelial Mucin Antibody
OAAV00271-200UG 200µg

OAAV00271-200UG - Breast Epithelial Mucin Antibody

Sign In for Pricing
View Details
E-cadherin (5F133)
sc-71007 50 µg - 0.5 mL

E-cadherin (5F133)

Sign In for Pricing
View Details
CD71 antibody (biotin)
MBS532648-01 0.5 mg

CD71 antibody (biotin)

Sign In for Pricing
View Details
CD71 antibody (biotin)
MBS532648-02 5x 0.5 mg

CD71 antibody (biotin)

Sign In for Pricing
View Details
Mouse sFlt-1 ELISA Kit
E068131 1 Each

Mouse sFlt-1 ELISA Kit

Sign In for Pricing
View Details
BMP4 (NM_130850) Human Tagged Lenti ORF Clone
RC219979L3 10 µg

BMP4 (NM_130850) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details