Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf30 Peptide - middle region

C2orf30 Peptide - middle region

Product Specifications

Product Name Alternative

CL24936, CL25084, XTP3TPB, CIM, XTP3-B, C2orf30

UniProt

Q96DZ1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2orf30 Rabbit Polyclonal Antibody (orb325979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056516

Preservative

Lyophilized powder

AA Sequence

GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL34P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41472061 1.0 µg DNA

RPL34P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
OR4F7P Protein Vector (Human) (pPB-N-His)
PV107131 500 ng

OR4F7P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Trimetrexate glucuronate
orb1686055-01 50 mg

Trimetrexate glucuronate

Sign In for Pricing
View Details
Trimetrexate glucuronate
orb1686055-02 100 mg

Trimetrexate glucuronate

Sign In for Pricing
View Details
Trimetrexate glucuronate
orb1686055-03 25 mg

Trimetrexate glucuronate

Sign In for Pricing
View Details
RNF186 Recombinant Protein (Mouse)
RP168584 100 µg

RNF186 Recombinant Protein (Mouse)

Sign In for Pricing
View Details