C2orf30 Peptide - middle region
C2orf30 Peptide - middle region
Product Specifications
Product Name Alternative
CL24936, CL25084, XTP3TPB, CIM, XTP3-B, C2orf30
UniProt
Q96DZ1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C2orf30 Rabbit Polyclonal Antibody (orb325979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056516
Preservative
Lyophilized powder
AA Sequence
GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Yyj6116-1mgEcoli 1 mg (E. coli)
Recombinant Schizosaccharomyces Pombe SPAC186.06 Protein (aa 1-184)
Sign In for Pricing
View Details 
orb1589919 100 µL
Phospho-FAK (Tyr407) Rabbit Polyclonal Antibody (BF405)
Sign In for Pricing
View Details 
abx103796-01 100 µL
Alpha-2-Heremans Schmid Glycoprotein (AHSG) Antibody
Sign In for Pricing
View Details