Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf30 Peptide - middle region

C2orf30 Peptide - middle region

Product Specifications

Product Name Alternative

CL24936, CL25084, XTP3TPB, CIM, XTP3-B, C2orf30

UniProt

Q96DZ1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2orf30 Rabbit Polyclonal Antibody (orb325979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056516

Preservative

Lyophilized powder

AA Sequence

GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEK-BD1 Cell Line (expressing Defensin 1 protein)
116079 1 Vial

HEK-BD1 Cell Line (expressing Defensin 1 protein)

Sign In for Pricing
View Details
Anti-Cytokeratin 18 antibody
STJ180142 0.1 ml

Anti-Cytokeratin 18 antibody

Sign In for Pricing
View Details
BTN3A2 Polyclonal Antibody, FITC Conjugated
A58276-050 50 µL

BTN3A2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Alfa Human Antibody
orb2975920-01 100 µg

Alfa Human Antibody

Sign In for Pricing
View Details
Alfa Human Antibody
orb2975920-02 1 mg

Alfa Human Antibody

Sign In for Pricing
View Details
JNJ-632 10mg
A20182-10 10 mg

JNJ-632 10mg

Sign In for Pricing
View Details