Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf22 Peptide - middle region

C3orf22 Peptide - middle region

Product Specifications

Product Name Alternative

MGC34728

UniProt

Q8N5N4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf22 Rabbit Polyclonal Antibody (orb581917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689746

Preservative

Lyophilized powder

AA Sequence

DSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSCA Antibody (YA3543, Mouse)
HY-P83846-01 10 µL

PSCA Antibody (YA3543, Mouse)

Sign In for Pricing
View Details
PSCA Antibody (YA3543, Mouse)
HY-P83846-02 50 μL

PSCA Antibody (YA3543, Mouse)

Sign In for Pricing
View Details
PSCA Antibody (YA3543, Mouse)
HY-P83846-03 100 µL

PSCA Antibody (YA3543, Mouse)

Sign In for Pricing
View Details
Human Bone Sialoprotein (BSP) ELISA Kit
YP-W10667-01 48 Tests

Human Bone Sialoprotein (BSP) ELISA Kit

Sign In for Pricing
View Details
Human Bone Sialoprotein (BSP) ELISA Kit
YP-W10667-02 96 Tests

Human Bone Sialoprotein (BSP) ELISA Kit

Sign In for Pricing
View Details
TLR4 Antibody
orb673066-01 50 µg

TLR4 Antibody

Sign In for Pricing
View Details