Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf22 Peptide - middle region

C3orf22 Peptide - middle region

Product Specifications

Product Name Alternative

MGC34728

UniProt

Q8N5N4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf22 Rabbit Polyclonal Antibody (orb581917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689746

Preservative

Lyophilized powder

AA Sequence

DSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Znf513 ELISA Kit
ELI-28670r 96 Tests

Rat Znf513 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Pdxk shRNA (UAS) - Lentiviral mouse Pdxk shRNA (UAS, iRFP) plasmid
GTR15262156 1 Vial

Lentiviral mouse Pdxk shRNA (UAS) - Lentiviral mouse Pdxk shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MOLM-13 Cells
116233 1 Vial

MOLM-13 Cells

Sign In for Pricing
View Details
Rpe65 Rat shRNA Plasmid (Locus ID 89826)
TL711965 1 Kit

Rpe65 Rat shRNA Plasmid (Locus ID 89826)

Sign In for Pricing
View Details
EphA2 (phospho-Ser897)  rabbit pAb
UB-GEN-12904 100 µL

EphA2 (phospho-Ser897) rabbit pAb

Sign In for Pricing
View Details
Human LDLRAP1 Protein Lysate
MBS8414410-01 0.02 mg

Human LDLRAP1 Protein Lysate

Sign In for Pricing
View Details