Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf33 Peptide - middle region

C3orf33 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ31139, AC3-33

UniProt

Q96NB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf33 Rabbit Polyclonal Antibody (orb580269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775928

Preservative

Lyophilized powder

AA Sequence

NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTRK2 Antibody
E308639 200 µL

NTRK2 Antibody

Sign In for Pricing
View Details
Recombinant Human Calcium and Integrin Binding 2
7-03879 1 mg

Recombinant Human Calcium and Integrin Binding 2

Sign In for Pricing
View Details
Tgfa Rat shRNA Lentiviral Particle (Locus ID 24827)
TL709303V 500 µL Each

Tgfa Rat shRNA Lentiviral Particle (Locus ID 24827)

Sign In for Pricing
View Details
Porcine Cholesteryl Ester Transfer Protein (CETP) ELISA Kit
MBS260811-01 48 Well

Porcine Cholesteryl Ester Transfer Protein (CETP) ELISA Kit

Sign In for Pricing
View Details
Porcine Cholesteryl Ester Transfer Protein (CETP) ELISA Kit
MBS260811-02 96 Well

Porcine Cholesteryl Ester Transfer Protein (CETP) ELISA Kit

Sign In for Pricing
View Details
Porcine Cholesteryl Ester Transfer Protein (CETP) ELISA Kit
MBS260811-03 5x 96 Well

Porcine Cholesteryl Ester Transfer Protein (CETP) ELISA Kit

Sign In for Pricing
View Details