Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf33 Peptide - middle region

C3orf33 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ31139, AC3-33

UniProt

Q96NB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf33 Rabbit Polyclonal Antibody (orb580269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775928

Preservative

Lyophilized powder

AA Sequence

NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXK1 CRISPR Activation Plasmid (m2)
sc-421682-ACT-2 20 µg

FOXK1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Bovine Cooperator of PRMT5 (COPR5)
MBS1146449-01 0.02 mg (E-Coli)

Recombinant Bovine Cooperator of PRMT5 (COPR5)

Sign In for Pricing
View Details
Recombinant Bovine Cooperator of PRMT5 (COPR5)
MBS1146449-02 0.1 mg (E-Coli)

Recombinant Bovine Cooperator of PRMT5 (COPR5)

Sign In for Pricing
View Details
Recombinant Bovine Cooperator of PRMT5 (COPR5)
MBS1146449-03 0.02 mg (Yeast)

Recombinant Bovine Cooperator of PRMT5 (COPR5)

Sign In for Pricing
View Details
Recombinant Bovine Cooperator of PRMT5 (COPR5)
MBS1146449-04 0.1 mg (Yeast)

Recombinant Bovine Cooperator of PRMT5 (COPR5)

Sign In for Pricing
View Details
Recombinant Bovine Cooperator of PRMT5 (COPR5)
MBS1146449-05 0.02 mg (Baculovirus)

Recombinant Bovine Cooperator of PRMT5 (COPR5)

Sign In for Pricing
View Details