C3orf67 Peptide - N-terminal region
C3orf67 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ42117, FLJ42930, MGC48416
UniProt
Q6ZVT6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C3orf67 Rabbit Polyclonal Antibody (orb581242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_940865
Preservative
Lyophilized powder
AA Sequence
TDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAESDQFINRG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880003-100 1x 100 µL
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
