Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5AR1 Peptide - C-terminal region

C5AR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C5A, C5AR, C5R1, CD88

UniProt

P21730

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C5AR1 Rabbit Polyclonal Antibody (orb584562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001727

Preservative

Lyophilized powder

AA Sequence

SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Pentraxin 3/TSG-14 Antibody (MM0512-6B7) [DyLight 755]
NBP2-11849IR 0.1 mL

Mouse Monoclonal Pentraxin 3/TSG-14 Antibody (MM0512-6B7) [DyLight 755]

Sign In for Pricing
View Details
FUT5 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2554156 100 µL

FUT5 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
ERBB3 Antibody
CSB-PA002404-01 50 µg

ERBB3 Antibody

Sign In for Pricing
View Details
ERBB3 Antibody
CSB-PA002404-02 100 µg

ERBB3 Antibody

Sign In for Pricing
View Details
Col13a1 ORF Vector (Rat) (pORF)
16554016 1.0 µg DNA

Col13a1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-19 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details