C5orf13 Peptide - N-terminal region
C5orf13 Peptide - N-terminal region
Product Specifications
Product Name Alternative
D4S114, P311, PRO1873, PTZ17, SEZ17, C5orf13
UniProt
Q16612
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C5orf13 Rabbit Polyclonal Antibody (orb584823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001135946
Preservative
Lyophilized powder
AA Sequence
REDETRTQRSRMTDRVPCSKCFQVYYPELFVWVSQEPFPNKDMEGRLPKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 