C6orf182 Peptide - middle region
C6orf182 Peptide - middle region
Product Specifications
Product Name Alternative
MGC21731, MGC70837, bA487F23.2, cep57R, C6orf182
UniProt
Q8IYX8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C6orf182 Rabbit Polyclonal Antibody (orb582854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_776191
Preservative
Lyophilized powder
AA Sequence
LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS122830 100 µg
MAK3 (NAA30) (NM_001011713) Human Over-expression Lysate
Sign In for Pricing
View Details MBS1012107-01 0.02 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup C NADH-quinone oxidoreductase subunit C (nuoC)
Sign In for Pricing
View Details MBS1012107-02 0.1 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup C NADH-quinone oxidoreductase subunit C (nuoC)
Sign In for Pricing
View Details