Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf182 Peptide - middle region

C6orf182 Peptide - middle region

Product Specifications

Product Name Alternative

MGC21731, MGC70837, bA487F23.2, cep57R, C6orf182

UniProt

Q8IYX8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C6orf182 Rabbit Polyclonal Antibody (orb582854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776191

Preservative

Lyophilized powder

AA Sequence

LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAV2 (Phospho-Tyr142) Antibody
8A1241-AAT 50 µg

VAV2 (Phospho-Tyr142) Antibody

Sign In for Pricing
View Details
GPR88 Double Nickase Plasmid (m2)
sc-425699-NIC-2 20 µg

GPR88 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
SFRP4 Rabbit mAb
59911 50 µL

SFRP4 Rabbit mAb

Sign In for Pricing
View Details
NMDA 2b Receptor, phosphorylated (Tyr1472) (NMDA R2b, N-methyl-D-aspartate, GRIN2B, Glutamate receptor ionotropic N-methyl D-aspartate 2B, HGNC:4586, NR2B, hNR3, N-methyl-D-aspartate receptor subunit 2B) (MaxLight 405) discontinued
N2904-35D1-ML405 100 µL

NMDA 2b Receptor, phosphorylated (Tyr1472) (NMDA R2b, N-methyl-D-aspartate, GRIN2B, Glutamate receptor ionotropic N-methyl D-aspartate 2B, HGNC:4586, NR2B, hNR3, N-methyl-D-aspartate receptor subunit 2B) (MaxLight 405) discontinued

Sign In for Pricing
View Details
4-carboxy TEMPO
MBS5802479 Inquire

4-carboxy TEMPO

Sign In for Pricing
View Details
Compound STOCK1N-50901
MBS5792556 Inquire

Compound STOCK1N-50901

Sign In for Pricing
View Details