Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C7orf16 Peptide - middle region

C7orf16 Peptide - middle region

Product Specifications

Product Name Alternative

GSBS, C7orf16

UniProt

O96001

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C7orf16 Rabbit Polyclonal Antibody (orb581626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006649

Preservative

Lyophilized powder

AA Sequence

IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ac-LEVD-pNA
A8758-25 25 mg

Ac-LEVD-pNA

Sign In for Pricing
View Details
Recombinant Rotavirus Rotavirus A Outer capsid protein VP4 Protein, His-SUMO, E.coli-1mg
QP7052-ec-1mg 1mg

Recombinant Rotavirus Rotavirus A Outer capsid protein VP4 Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
Transverse section of a leaf
4041800/6A 1 Each

Transverse section of a leaf

Sign In for Pricing
View Details
Hamster Asialoglycoprotein receptor 1 (ASGR1) ELISA Kit
MBS2802906-01 48 Tests

Hamster Asialoglycoprotein receptor 1 (ASGR1) ELISA Kit

Sign In for Pricing
View Details
Hamster Asialoglycoprotein receptor 1 (ASGR1) ELISA Kit
MBS2802906-02 96 Tests

Hamster Asialoglycoprotein receptor 1 (ASGR1) ELISA Kit

Sign In for Pricing
View Details
Hamster Asialoglycoprotein receptor 1 (ASGR1) ELISA Kit
MBS2802906-03 5x 96 Tests

Hamster Asialoglycoprotein receptor 1 (ASGR1) ELISA Kit

Sign In for Pricing
View Details