Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf45 Peptide - middle region

C8orf45 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25692, C8orf45

UniProt

Q4G0Z9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf45 Rabbit Polyclonal Antibody (orb582010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775789

Preservative

Lyophilized powder

AA Sequence

IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpne6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16764114 3x 1.0 µg

Cpne6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RIPK5 (DSTYK) CytoSection
TS409967P5 25 Slides

RIPK5 (DSTYK) CytoSection

Sign In for Pricing
View Details
DDX58 Rabbit mAb
AB100697 100 µL

DDX58 Rabbit mAb

Sign In for Pricing
View Details
GPR85 Polyclonal Antibody
UB-GEN-13145 100 µL

GPR85 Polyclonal Antibody

Sign In for Pricing
View Details
Scoc (NM_001013235) Rat Tagged Lenti ORF Clone
RR213966L4 10 µg

Scoc (NM_001013235) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GUCY1A1 (NM_000856) Human Mass Spec Standard
PH306063 10 µg

GUCY1A1 (NM_000856) Human Mass Spec Standard

Sign In for Pricing
View Details