Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf45 Peptide - middle region

C8orf45 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25692, C8orf45

UniProt

Q4G0Z9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf45 Rabbit Polyclonal Antibody (orb582010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775789

Preservative

Lyophilized powder

AA Sequence

IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Hip Protein
MBS9141789-01 0.01 mg

Recombinant Human Hip Protein

Sign In for Pricing
View Details
Recombinant Human Hip Protein
MBS9141789-02 0.02 mg

Recombinant Human Hip Protein

Sign In for Pricing
View Details
Recombinant Human Hip Protein
MBS9141789-03 0.05 mg

Recombinant Human Hip Protein

Sign In for Pricing
View Details
Recombinant Human Hip Protein
MBS9141789-04 0.1 mg

Recombinant Human Hip Protein

Sign In for Pricing
View Details
Recombinant Human Hip Protein
MBS9141789-05 5x 0.1 mg

Recombinant Human Hip Protein

Sign In for Pricing
View Details
Recombinant Clostridium acetobutylicum Phosphate acyltransferase (plsX)
MBS1483144-01 0.02 mg (E-Coli)

Recombinant Clostridium acetobutylicum Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details