Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf45 Peptide - middle region

C8orf45 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25692, C8orf45

UniProt

Q4G0Z9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf45 Rabbit Polyclonal Antibody (orb582011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775789

Preservative

Lyophilized powder

AA Sequence

RSITVYIPGKKFGEDIDQQMTFPVQCSFWSFVDVDSSSRRNAQKINTLIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin-36 Polyclonal Antibody, APC Conjugated
bs-1266R-APC 100 µL

Connexin-36 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Clear Seal 640 Seal Roll
PCR0646 1 Roll

Clear Seal 640 Seal Roll

Sign In for Pricing
View Details
N, N-Dimethyl-5-[ (methylamino) methyl]pyridin-2-amine
EHA87346-01 50 mg

N, N-Dimethyl-5-[ (methylamino) methyl]pyridin-2-amine

Sign In for Pricing
View Details
N, N-Dimethyl-5-[ (methylamino) methyl]pyridin-2-amine
EHA87346-02 0.5 g

N, N-Dimethyl-5-[ (methylamino) methyl]pyridin-2-amine

Sign In for Pricing
View Details
RPS13 Antibody - middle region
OAAB02220-400UL 400 µL

RPS13 Antibody - middle region

Sign In for Pricing
View Details
CCDC3 CRISPR/Cas9 KO Plasmid (h)
sc-410623 20 µg

CCDC3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details