Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMO Peptide - middle region

TRMO Peptide - middle region

Product Specifications

Product Name Alternative

NAP1, HSPC219, C9orf156

UniProt

Q9BU70

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMO Rabbit Polyclonal Antibody (orb585192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057565

Preservative

Lyophilized powder

AA Sequence

SCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E99P Protein Vector (Human) (pPB-C-His)
PV108770 500 ng

OR7E99P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
WASF1 Polyclonal Antibody
orb616304-01 50 μL

WASF1 Polyclonal Antibody

Sign In for Pricing
View Details
WASF1 Polyclonal Antibody
orb616304-02 100 µL

WASF1 Polyclonal Antibody

Sign In for Pricing
View Details
EphA1 Antibody (C-term)
orb1929105-01 50 µL

EphA1 Antibody (C-term)

Sign In for Pricing
View Details
EphA1 Antibody (C-term)
orb1929105-02 100 µL

EphA1 Antibody (C-term)

Sign In for Pricing
View Details
Ro 48-8071
B4859-5.1 10 mM (in 1mL DMSO)

Ro 48-8071

Sign In for Pricing
View Details