Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMO Peptide - middle region

TRMO Peptide - middle region

Product Specifications

Product Name Alternative

NAP1, HSPC219, C9orf156

UniProt

Q9BU70

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMO Rabbit Polyclonal Antibody (orb585192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057565

Preservative

Lyophilized powder

AA Sequence

SCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-Cyclin B2 Rabbit mAb
MBS8326722-01 0.03 mL

Recombinant Anti-Cyclin B2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cyclin B2 Rabbit mAb
MBS8326722-02 0.05 mL

Recombinant Anti-Cyclin B2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cyclin B2 Rabbit mAb
MBS8326722-03 0.1 mL

Recombinant Anti-Cyclin B2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cyclin B2 Rabbit mAb
MBS8326722-04 0.2 mL

Recombinant Anti-Cyclin B2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Cyclin B2 Rabbit mAb
MBS8326722-05 5x 0.2 mL

Recombinant Anti-Cyclin B2 Rabbit mAb

Sign In for Pricing
View Details
Anti-ESD Antibody Picoband® Fluoro488 Conjugated
A01471-1-Fluoro488 100 µg/Vial

Anti-ESD Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details