Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf30 Peptide - middle region

C9orf30 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ34973, L8, MGC17337, C9orf30

UniProt

Q96H12

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C9orf30 Rabbit Polyclonal Antibody (orb585536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542386

Preservative

Lyophilized powder

AA Sequence

LSTHVLGKEKIASMLPEQLYFLQSPPEEEPEYHPDASAQESFAVSNRELC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CATSPER2P1 Human qPCR Primer Pair (NR_002318)
HP220028 200 Reactions

CATSPER2P1 Human qPCR Primer Pair (NR_002318)

Sign In for Pricing
View Details
NDUFA4 Rabbit Polyclonal Antibody
AP20126PU-N 100 µg

NDUFA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TAFA3 activation kit by CRISPRa
GA117157 1 Kit

Human TAFA3 activation kit by CRISPRa

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF594 conjugate, 0.1mg/mL
BNC940487-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDC25A Rabbit Polyclonal Antibody
AP02684PU-S 50 µL

CDC25A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acenaphthene (1,2-Dihydro Acenaphthylene)
TRC-D448330-10G 10 g

Acenaphthene (1,2-Dihydro Acenaphthylene)

Sign In for Pricing
View Details