Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf30 Peptide - middle region

C9orf30 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ34973, L8, MGC17337, C9orf30

UniProt

Q96H12

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C9orf30 Rabbit Polyclonal Antibody (orb585536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542386

Preservative

Lyophilized powder

AA Sequence

LSTHVLGKEKIASMLPEQLYFLQSPPEEEPEYHPDASAQESFAVSNRELC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473), CF594 conjugate, 0.1mg/mL
BNC940473-500 1x 500 µL

CD5 (C5/473), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Il17a Mouse Recombinant Protein
TP721376 10 µg

Il17a Mouse Recombinant Protein

Sign In for Pricing
View Details
BRD8 Rabbit Polyclonal Antibody
TA371274 100 µL

BRD8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF488A conjugate, 0.1mg/mL
BNC882988-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Acetyl-S-(2-carboxypropyl)-L-cysteine Ethyl Ester (Mixture of Diastereomers)
TRC-A172020-10MG 10 mg

N-Acetyl-S-(2-carboxypropyl)-L-cysteine Ethyl Ester (Mixture of Diastereomers)

Sign In for Pricing
View Details
2-(Diethylamino)ethyl 4-amino-3-butoxybenzoate
TRC-D680620-50MG 50 mg

2-(Diethylamino)ethyl 4-amino-3-butoxybenzoate

Sign In for Pricing
View Details