Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf64 Peptide - N-terminal region

C9orf64 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC10999, RP11-575L7.5

UniProt

Q5T6V5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C9orf64 Rabbit Polyclonal Antibody (orb584668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115683

Preservative

Lyophilized powder

AA Sequence

RVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF405S conjugate, 0.1mg/mL
BNC042475-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF640R conjugate, 0.1mg/mL
BNC401126-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL
BNC471880-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (TRP/816), CF640R conjugate, 0.1mg/mL
BNC400816-500 1x 500 µL

P53 (TRP/816), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details