Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Peptide - N-terminal region

CA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CA-II, CAII, Car2

UniProt

P00918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA2 Rabbit Polyclonal Antibody (orb584567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000058

Preservative

Lyophilized powder

AA Sequence

SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl30 (BC002060) Mouse Tagged ORF Clone
MG200480 10 µg

Rpl30 (BC002060) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bcl-2 (100/D5), 0.2mg/mL
BNUB0045-500 1x 500 µL

Bcl-2 (100/D5), 0.2mg/mL

Sign In for Pricing
View Details
Human IKZF5 activation kit by CRISPRa
GA112050 1 Kit

Human IKZF5 activation kit by CRISPRa

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1280-01 50 μL

PKC-beta 1 Antibody

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1280-02 100 µL

PKC-beta 1 Antibody

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1280-03 1 mL

PKC-beta 1 Antibody

Sign In for Pricing
View Details