Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Peptide - N-terminal region

CA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CA-II, CAII, Car2

UniProt

P00918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA2 Rabbit Polyclonal Antibody (orb584567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000058

Preservative

Lyophilized powder

AA Sequence

SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparan Sulphate Proteoglycan (A7L6), CF405S conjugate, 0.1mg/mL
BNC040315-100 1x 100 µL

Heparan Sulphate Proteoglycan (A7L6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RTL6 (NM_032287) Human Recombinant Protein
TP306668M 100 µg

RTL6 (NM_032287) Human Recombinant Protein

Sign In for Pricing
View Details
Cdh8 Mouse Gene Knockout Kit (CRISPR)
KN503018 1 Kit

Cdh8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bulk Anti-Human CD3 (UCHT-1) Antibody
ICH1002-100mg 100 mg

Bulk Anti-Human CD3 (UCHT-1) Antibody

Sign In for Pricing
View Details
Nogo Receptor (RTN4R) (NM_023004) Human Over-expression Lysate
LY402954 100 µg

Nogo Receptor (RTN4R) (NM_023004) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB524431 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details