Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA5A Peptide - C-terminal region

CA5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CA5, CAV, CAVA

UniProt

P35218

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA5A Rabbit Polyclonal Antibody (orb584568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001730

Preservative

Lyophilized powder

AA Sequence

PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S100A16 Antibody (S100A16/7411) [Alexa Fluor 532]
NBP3-27050AF532 0.1 mL

Mouse Monoclonal S100A16 Antibody (S100A16/7411) [Alexa Fluor 532]

Sign In for Pricing
View Details
p38 alpha (K53A), Unactive recombinant protein
MBS515300-01 0.02 mg

p38 alpha (K53A), Unactive recombinant protein

Sign In for Pricing
View Details
p38 alpha (K53A), Unactive recombinant protein
MBS515300-02 0.1 mg

p38 alpha (K53A), Unactive recombinant protein

Sign In for Pricing
View Details
p38 alpha (K53A), Unactive recombinant protein
MBS515300-03 1 mg

p38 alpha (K53A), Unactive recombinant protein

Sign In for Pricing
View Details
p38 alpha (K53A), Unactive recombinant protein
MBS515300-04 5x 1 mg

p38 alpha (K53A), Unactive recombinant protein

Sign In for Pricing
View Details
DCP1A (NM_001290204) Human Tagged ORF Clone
RC238825 10 µg

DCP1A (NM_001290204) Human Tagged ORF Clone

Sign In for Pricing
View Details