Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA5A Peptide - C-terminal region

CA5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CA5, CAV, CAVA

UniProt

P35218

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA5A Rabbit Polyclonal Antibody (orb584569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001730

Preservative

Lyophilized powder

AA Sequence

AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin Recombinant Rabbit monoclonal Antibody
HA750094 100 µL

Calponin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1-(5-Fluoropentyl)-1H-indole-3-carboxylic Acid
TRC-F143275-250MG 250 mg

1-(5-Fluoropentyl)-1H-indole-3-carboxylic Acid

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL
BNC941777-100 1x 100 µL

Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COG7 (NM_153603) Human Recombinant Protein
TP307130M 100 µg

COG7 (NM_153603) Human Recombinant Protein

Sign In for Pricing
View Details
GABPB2 (NM_144618) Human Recombinant Protein
TP305763L 1 mg

GABPB2 (NM_144618) Human Recombinant Protein

Sign In for Pricing
View Details
Spcs2 Mouse Gene Knockout Kit (CRISPR)
KN516574 1 Kit

Spcs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details