Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39L Peptide - N-terminal region

CAB39L Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ12577, MO25-BETA, MO2L, RP11-103J18.3, bA103J18.3

UniProt

Q9H9S4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAB39L Rabbit Polyclonal Antibody (orb584784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112187

Preservative

Lyophilized powder

AA Sequence

EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cytosolic carboxypeptidase 1, Agtpbp1 ELISA KIT
ELI-50195m 96 Tests

Mouse Cytosolic carboxypeptidase 1, Agtpbp1 ELISA KIT

Sign In for Pricing
View Details
Anti-CIRBP Antibody
A04103 100 µL

Anti-CIRBP Antibody

Sign In for Pricing
View Details
DMRT1 Antibody, FITC conjugated
CSB-PA896914LC01HU-01 50 µg

DMRT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
DMRT1 Antibody, FITC conjugated
CSB-PA896914LC01HU-02 100 µg

DMRT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
groEL Antibody
MBS7153721 Inquire

groEL Antibody

Sign In for Pricing
View Details
ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) (MaxLight 650)
MBS6220858-01 0.1 mL

ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) (MaxLight 650)

Sign In for Pricing
View Details