Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39L Peptide - N-terminal region

CAB39L Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ12577, MO25-BETA, MO2L, RP11-103J18.3, bA103J18.3

UniProt

Q9H9S4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAB39L Rabbit Polyclonal Antibody (orb584784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112187

Preservative

Lyophilized powder

AA Sequence

EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Period Circadian Protein Homolog 2 (PER2) ELISA Kit
MBS9909836 Inquire

Cavy Period Circadian Protein Homolog 2 (PER2) ELISA Kit

Sign In for Pricing
View Details
Eukaryotic Rat Factor Related Apoptosis (FAS)
RPU54812-01 50 µg

Eukaryotic Rat Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Rat Factor Related Apoptosis (FAS)
RPU54812-02 100 µg

Eukaryotic Rat Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Rat Factor Related Apoptosis (FAS)
RPU54812-03 1 mg

Eukaryotic Rat Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
MIR3128 ORF Vector (Human) (pORF)
ORF023931 1.0 µg DNA

MIR3128 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
14-3-3 beta Polyclonal Antibody, HRP Conjugated
bs-12420R-HRP 100 µL

14-3-3 beta Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details