Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP4 Peptide - N-terminal region

CABP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSNB2B

UniProt

P57796

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABP4 Rabbit Polyclonal Antibody (orb584462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660201

Preservative

Lyophilized powder

AA Sequence

PSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF189 Human Gene Knockout Kit (CRISPR)
KN417848 1 Kit

ZNF189 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor A3/LILRA3/ILT6/CD85e (C-Fc)
PKSH034013-01 10 µg

Recombinant Human Leukocyte Ig-Like Receptor A3/LILRA3/ILT6/CD85e (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor A3/LILRA3/ILT6/CD85e (C-Fc)
PKSH034013-02 50 µg

Recombinant Human Leukocyte Ig-Like Receptor A3/LILRA3/ILT6/CD85e (C-Fc)

Sign In for Pricing
View Details
Ccdc80 Mouse Gene Knockout Kit (CRISPR)
KN502749 1 Kit

Ccdc80 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANKHD1 Rabbit Polyclonal Antibody
TA373514 100 µL

ANKHD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD36 Antibody[5-271]
E-AB-F1164C-01 20 Tests

FITC Anti-Human CD36 Antibody[5-271]

Sign In for Pricing
View Details