Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D4 Peptide - C-terminal region

CACNA2D4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCD4

UniProt

Q7Z3S7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CACNA2D4 Rabbit Polyclonal Antibody (orb584467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758952

Preservative

Lyophilized powder

AA Sequence

MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)
PKSH033561-01 10 µg

Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)
PKSH033561-02 50 µg

Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35 + MSA/953), CF568 conjugate, 0.1mg/mL
BNC681013-500 1x 500 µL

Muscle Specific Actin (HHF35 + MSA/953), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Citraconic anhydride
TRC-C520513-500MG 500 mg

Citraconic anhydride

Sign In for Pricing
View Details
SPATA31A3 Human Gene Knockout Kit (CRISPR)
KN417331 1 Kit

SPATA31A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Bromopentadecane
TRC-B686155-50G 50 g

1-Bromopentadecane

Sign In for Pricing
View Details